Lineage for d1sxtb2 (1sxt B:121-233)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541483Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 2541484Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)
  8. 2541490Domain d1sxtb2: 1sxt B:121-233 [37740]
    Other proteins in same PDB: d1sxta1, d1sxtb1
    complexed with zn

Details for d1sxtb2

PDB Entry: 1sxt (more details), 2.7 Å

PDB Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc
PDB Compounds: (B:) staphylococcal enterotoxin type a

SCOPe Domain Sequences for d1sxtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxtb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOPe Domain Coordinates for d1sxtb2:

Click to download the PDB-style file with coordinates for d1sxtb2.
(The format of our PDB-style files is described here.)

Timeline for d1sxtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sxtb1