SCOPe 2.03: Domain d1sxtb2: 1sxt B:121-233

Lineage for d1sxtb2 (1sxt B:121-233)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)

8. Domain d1sxtb2: 1sxt B:121-233 [37740]
   Other proteins in same PDB: d1sxta1, d1sxtb1
   complexed with zn

Details for d1sxtb2

PDB Entry: 1sxt, 2.7 Å

PDB Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc

PDB Compounds: (B:) staphylococcal enterotoxin type a

SCOPe Domain Sequences for d1sxtb2:

Sequence; same for both SEQRES and ATOM records:

>d1sxtb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

Timeline for d1sxtb2:

• d1sxtb2 first appeared (with stable ids) in SCOP 1.55
  
• d1sxtb2 appears in SCOPe 2.02
  
• d1sxtb2 appears in SCOPe 2.04
  
• d1sxtb2 appears in the current release, SCOPe 2.08