Lineage for d1sxta2 (1sxt A:121-233)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254364Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 254365Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)
  8. 254370Domain d1sxta2: 1sxt A:121-233 [37739]
    Other proteins in same PDB: d1sxta1, d1sxtb1

Details for d1sxta2

PDB Entry: 1sxt (more details), 2.7 Å

PDB Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc

SCOP Domain Sequences for d1sxta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxta2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOP Domain Coordinates for d1sxta2:

Click to download the PDB-style file with coordinates for d1sxta2.
(The format of our PDB-style files is described here.)

Timeline for d1sxta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sxta1