SCOPe 2.08: Domain d6itkb2: 6itk B:161-328

Lineage for d6itkb2 (6itk B:161-328)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:196627] [377323] (1 PDB entry)

8. Domain d6itkb2: 6itk B:161-328 [377383]
   Other proteins in same PDB: d6itka1, d6itka3, d6itkb1, d6itkb3
   automated match to d4tvoa2
   complexed with lmr, nad

Details for d6itkb2

PDB Entry: 6itk, 2 Å

PDB Description: crystal structure of malate dehydrogenase from corynebacterium glutamicum atcc 13032 in complex with nad and malate

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d6itkb2:

Sequence; same for both SEQRES and ATOM records:

>d6itkb2 d.162.1.0 (B:161-328) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
mrldhnraisqlatklgrgsaefnnivvwgnhsatqfpdityatvggekvtdlvdhdwyv
eefiprvanrgaeiievrgkssaasaassaidhmrdwvqgteawssaaipstgaygipeg
ifvglptvsrngeweivegleisdfqraridanaqelqaereavrdll

Timeline for d6itkb2:

• d6itkb2 first appeared in SCOPe 2.07