SCOPe 2.08: Domain d1i4gb2: 1i4g B:121-233

Lineage for d1i4gb2 (1i4g B:121-233)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (7 PDB entries)

8. Domain d1i4gb2: 1i4g B:121-233 [37738]
   Other proteins in same PDB: d1i4ga1, d1i4gb1
   complexed with so4, zn; mutant

Details for d1i4gb2

PDB Entry: 1i4g, 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity

PDB Compounds: (B:) enterotoxin type a

SCOPe Domain Sequences for d1i4gb2:

Sequence; same for both SEQRES and ATOM records:

>d1i4gb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

Timeline for d1i4gb2:

• d1i4gb2 first appeared (with stable ids) in SCOP 1.55
  
• d1i4gb2 appears in SCOPe 2.07