Lineage for d1i4ga2 (1i4g A:121-233)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 717878Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 717879Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)
  8. 717882Domain d1i4ga2: 1i4g A:121-233 [37737]
    Other proteins in same PDB: d1i4ga1, d1i4gb1

Details for d1i4ga2

PDB Entry: 1i4g (more details), 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin a mutant h187a with reduced zn2+ affinity
PDB Compounds: (A:) enterotoxin type a

SCOP Domain Sequences for d1i4ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4ga2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOP Domain Coordinates for d1i4ga2:

Click to download the PDB-style file with coordinates for d1i4ga2.
(The format of our PDB-style files is described here.)

Timeline for d1i4ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4ga1