Lineage for d6l6la_ (6l6l A:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
alpha+beta metal(zinc)-bound foldSuperfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) 
Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
duplication: two zinc-binding motifs
Protein automated matches [190314] (3 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188623] (6 PDB entries) 
Domain d6l6la_: 6l6l A: [377369]
automated match to d1a6yb_
complexed with zn
Details for d6l6la_
PDB Entry: 6l6l (more details), 2.78 Å
PDB Description: structural basis of nr4a2 homodimers binding to selective nur- responsive elements
PDB Compounds: (A:) Nuclear receptor related 1SCOPe Domain Sequences for d6l6la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l6la_ g.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lcavcgdnaacqhygvrtcegckgffkrtvqknakyvclankncpvdkrrrnrcqycrfq
kclavgmvkevvrtdslkgrrgrlp
SCOPe Domain Coordinates for d6l6la_:
Click to download the PDB-style file with coordinates for d6l6la_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6l6la_:
- d6l6la_ first appeared in SCOPe 2.07
View in 3D
