![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [53962] (854 PDB entries) Uniprot P00698 |
![]() | Domain d6lava_: 6lav A: [377366] automated match to d3lzta_ complexed with act |
PDB Entry: 6lav (more details), 1.73 Å
SCOPe Domain Sequences for d6lava_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lava_ d.2.1.2 (A:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d6lava_: