![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin A, SEA [54336] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries) |
![]() | Domain d1esfa2: 1esf A:121-233 [37735] Other proteins in same PDB: d1esfa1, d1esfb1 complexed with cd |
PDB Entry: 1esf (more details), 1.9 Å
SCOPe Domain Sequences for d1esfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esfa2 d.15.6.1 (A:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]} eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
Timeline for d1esfa2: