Lineage for d6jh7a_ (6jh7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847631Species Microcystis aeruginosa [TaxId:1235808] [377327] (3 PDB entries)
  8. 2847632Domain d6jh7a_: 6jh7 A: [377341]
    automated match to d3oifb_
    complexed with act, peg, pge

Details for d6jh7a_

PDB Entry: 6jh7 (more details), 1.38 Å

PDB Description: crystal structure of aerf from microcystis aeruginosa
PDB Compounds: (A:) Short chain dehydrogenase family protein

SCOPe Domain Sequences for d6jh7a_:

Sequence, based on SEQRES records: (download)

>d6jh7a_ c.2.1.0 (A:) automated matches {Microcystis aeruginosa [TaxId: 1235808]}
mdlglkdkvalitgssagigftiaeklaeegchliicgrnsqrleqayqslaqaypaqqi
lrlvadvhqaqdseqliqdslnqygkidilvnnseganfaenlienlsdedwlnvfqgkl
igyirltnlvlpimkkqhwgrivniigtsgkepsprlvksgvvnaalmnftksvarqtap
ynvlinsvnpgvidtprhreyleiyakkegttpdlirerilktipmnrigtteefanlvv
flasecasyitgitipldgglss

Sequence, based on observed residues (ATOM records): (download)

>d6jh7a_ c.2.1.0 (A:) automated matches {Microcystis aeruginosa [TaxId: 1235808]}
mdlglkdkvalitgssagigftiaeklaeegchliicgrnsqrleqayqslaqaypaqqi
lrlvadvhqaqdseqliqdslnqygkidilvnnsegaenlienlsdedwlnvfqgkligy
irltnlvlpimkkqhwgrivniigtsgkepsprlvksgvvnaalmnftksvarqtapynv
linsvnpgvidtprhreyleiyakkegttpdlirerilktipmnrigtteefanlvvfla
secasyitgitipldgglss

SCOPe Domain Coordinates for d6jh7a_:

Click to download the PDB-style file with coordinates for d6jh7a_.
(The format of our PDB-style files is described here.)

Timeline for d6jh7a_: