Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (47 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:196627] [377323] (1 PDB entry) |
Domain d6itka2: 6itk A:161-328 [377324] Other proteins in same PDB: d6itka1, d6itka3, d6itkb1, d6itkb3 automated match to d4tvoa2 complexed with lmr, nad |
PDB Entry: 6itk (more details), 2 Å
SCOPe Domain Sequences for d6itka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6itka2 d.162.1.0 (A:161-328) automated matches {Corynebacterium glutamicum [TaxId: 196627]} mrldhnraisqlatklgrgsaefnnivvwgnhsatqfpdityatvggekvtdlvdhdwyv eefiprvanrgaeiievrgkssaasaassaidhmrdwvqgteawssaaipstgaygipeg ifvglptvsrngeweivegleisdfqraridanaqelqaereavrdll
Timeline for d6itka2: