Lineage for d6itka1 (6itk A:8-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846658Species Corynebacterium glutamicum [TaxId:196627] [315006] (3 PDB entries)
  8. 2846659Domain d6itka1: 6itk A:8-160 [377322]
    Other proteins in same PDB: d6itka2, d6itka3, d6itkb2, d6itkb3
    automated match to d4tvoa1
    complexed with lmr, nad

Details for d6itka1

PDB Entry: 6itk (more details), 2 Å

PDB Description: crystal structure of malate dehydrogenase from corynebacterium glutamicum atcc 13032 in complex with nad and malate
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d6itka1:

Sequence, based on SEQRES records: (download)

>d6itka1 c.2.1.0 (A:8-160) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
stkkvtvtgaagqisysllwriangevfgtdtpvelklleipqalggaegvamelldsaf
pllrnititadaneafdganaaflvgakprgkgeeradllanngkifgpqgkaindnaad
dirvlvvgnpantnaliasaaapdvpasrfnam

Sequence, based on observed residues (ATOM records): (download)

>d6itka1 c.2.1.0 (A:8-160) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
stkkvtvtgaagqisysllwriangevfgtdtpvelklleipqalggaegvamelldsaf
pllrnititadaneafdganaaflvgakperadllanngkifgpqgkaindnaaddirvl
vvgnpantnaliasaaapdvpasrfnam

SCOPe Domain Coordinates for d6itka1:

Click to download the PDB-style file with coordinates for d6itka1.
(The format of our PDB-style files is described here.)

Timeline for d6itka1: