Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Caulobacter vibrioides [TaxId:190650] [377308] (1 PDB entry) |
Domain d6jirb2: 6jir B:119-250 [377316] Other proteins in same PDB: d6jira4, d6jirb4 automated match to d5wcea2 complexed with edo, gol, p6g, peg, pge |
PDB Entry: 6jir (more details), 1.95 Å
SCOPe Domain Sequences for d6jirb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jirb2 d.131.1.0 (B:119-250) automated matches {Caulobacter vibrioides [TaxId: 190650]} vmssdglssriavdtnelirlidktrfaisteetryylnglyvhtvneggetklravatd ghrlalaempapegavgipgvivprktiaearrlmesagetvdlqvspqkvrfefgaaal tskvidgafpdy
Timeline for d6jirb2:
View in 3D Domains from other chains: (mouse over for more information) d6jira1, d6jira2, d6jira3, d6jira4 |