Lineage for d6jirb2 (6jir B:119-250)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583764Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2583765Protein automated matches [226907] (28 species)
    not a true protein
  7. 2583857Species Caulobacter vibrioides [TaxId:190650] [377308] (1 PDB entry)
  8. 2583862Domain d6jirb2: 6jir B:119-250 [377316]
    Other proteins in same PDB: d6jira4, d6jirb4
    automated match to d5wcea2
    complexed with edo, gol, p6g, peg, pge

Details for d6jirb2

PDB Entry: 6jir (more details), 1.95 Å

PDB Description: crystal structure of c. crescentus beta sliding clamp with peg bound to putative beta-motif tethering region
PDB Compounds: (B:) Beta sliding clamp

SCOPe Domain Sequences for d6jirb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jirb2 d.131.1.0 (B:119-250) automated matches {Caulobacter vibrioides [TaxId: 190650]}
vmssdglssriavdtnelirlidktrfaisteetryylnglyvhtvneggetklravatd
ghrlalaempapegavgipgvivprktiaearrlmesagetvdlqvspqkvrfefgaaal
tskvidgafpdy

SCOPe Domain Coordinates for d6jirb2:

Click to download the PDB-style file with coordinates for d6jirb2.
(The format of our PDB-style files is described here.)

Timeline for d6jirb2: