SCOPe 2.07: Domain d6idzb_: 6idz B:

Lineage for d6idzb_ (6idz B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (36 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)

8. Domain d6idzb_: 6idz B: [377307]
   Other proteins in same PDB: d6idza_
   automated match to d4d00d_
   complexed with gal, nag, sia; mutant

Details for d6idzb_

PDB Entry: 6idz, 2.71 Å

PDB Description: crystal structure of h7 hemagglutinin mutant h7-svtq ( a138s, p221t, l226q) with 3'sln

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6idzb_:

Sequence; same for both SEQRES and ATOM records:

>d6idzb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
fiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnqqfelidn
efnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyervkrqlre
naeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

Timeline for d6idzb_:

• d6idzb_ is new in SCOPe 2.07-stable
  
• d6idzb_ appears in the current release, SCOPe 2.08