Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries) |
Domain d6id2a_: 6id2 A: [377306] Other proteins in same PDB: d6id2b_, d6id2d_, d6id2f_, d6id2h_, d6id2j_, d6id2l_ automated match to d4n62a_ mutant |
PDB Entry: 6id2 (more details), 2.71 Å
SCOPe Domain Sequences for d6id2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id2a_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 1332244]} iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvstaeq tklygsgnklvtvgssnyqqsfvpspgartqvnglsgridfhwlmlnpndtvtfsfngaf iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq rslllatgmknvpe
Timeline for d6id2a_: