Lineage for d1bmlc2 (1bml C:149-284)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854438Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) (S)
  5. 854439Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)
  6. 854452Protein Streptokinase [54332] (1 species)
    duplication: consists of three similar domains
  7. 854453Species Streptococcus equisimilis [TaxId:119602] [54333] (5 PDB entries)
  8. 854465Domain d1bmlc2: 1bml C:149-284 [37730]
    Other proteins in same PDB: d1bmla_, d1bmlb_

Details for d1bmlc2

PDB Entry: 1bml (more details), 2.9 Å

PDB Description: complex of the catalytic domain of human plasmin and streptokinase
PDB Compounds: (C:) Streptokinase

SCOP Domain Sequences for d1bmlc2:

Sequence, based on SEQRES records: (download)

>d1bmlc2 d.15.5.1 (C:149-284) Streptokinase {Streptococcus equisimilis [TaxId: 119602]}
kpiqnqaksvdveytvqftplnpdddfrpglkdtkllktlaigdtitsqellaqaqsiln
kthpgytiyerdssivthdndifrtilpmdqeftyhvknreqayeinkksglneeinntd
lisekyyvlkkgekpy

Sequence, based on observed residues (ATOM records): (download)

>d1bmlc2 d.15.5.1 (C:149-284) Streptokinase {Streptococcus equisimilis [TaxId: 119602]}
kpiqnqaksvdveytvqftplnpdddtkllktlaigdtitsqellaqaqsilnkthpgyt
iyerdssivthdndifrtilpmdqeftyhvknreqaeinntdlisekyyvlkkgekpy

SCOP Domain Coordinates for d1bmlc2:

Click to download the PDB-style file with coordinates for d1bmlc2.
(The format of our PDB-style files is described here.)

Timeline for d1bmlc2: