Lineage for d6i72b1 (6i72 B:14-119)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694759Species Fragaria ananassa [TaxId:3747] [377209] (5 PDB entries)
  8. 2694765Domain d6i72b1: 6i72 B:14-119 [377295]
    Other proteins in same PDB: d6i72a2, d6i72b2
    automated match to d1kyze1
    complexed with dhc, edo, sah, so4

Details for d6i72b1

PDB Entry: 6i72 (more details), 1.5 Å

PDB Description: structure of fragaria ananassa o-methyltransferase in complex with s- adenosylhomocysteine and caffeic acid
PDB Compounds: (B:) O-methyltransferase

SCOPe Domain Sequences for d6i72b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i72b1 a.4.5.0 (B:14-119) automated matches {Fragaria ananassa [TaxId: 3747]}
vsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdlasqlptknpea
pvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltkne

SCOPe Domain Coordinates for d6i72b1:

Click to download the PDB-style file with coordinates for d6i72b1.
(The format of our PDB-style files is described here.)

Timeline for d6i72b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6i72b2