SCOPe 2.08: Domain d6i5xd1: 6i5x D:7-264

Lineage for d6i5xd1 (6i5x D:7-264)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Neosartorya fumigata [TaxId:746128] [377239] (1 PDB entry)

8. Domain d6i5xd1: 6i5x D:7-264 [377289]
   Other proteins in same PDB: d6i5xa2, d6i5xb2, d6i5xc2, d6i5xd2
   automated match to d5ue7a_
   complexed with cl, mg, peg

Details for d6i5xd1

PDB Entry: 6i5x, 2.2 Å

PDB Description: crystal structure of aspergillus fumigatus phosphomannomutase

PDB Compounds: (D:) Phosphomannomutase

SCOPe Domain Sequences for d6i5xd1:

Sequence; same for both SEQRES and ATOM records:

>d6i5xd1 c.108.1.0 (D:7-264) automated matches {Neosartorya fumigata [TaxId: 746128]}
lqdrpiknticlfdvdetltparravtpemlmllsqlrhkcaigyvggsnlakqqeqlgt
gatdvtslfdfcfpenglmafrlgkplastsfiewigeekyqklvnfilryfadlqlpkk
rgtfiefrngminvspigrnasveernefeaydkehhirtdmvnalkkefpdygltysig
gqisfdvfptgwdktyclrhveaekeisgveyttihffgdkcfpggndyeiysdprtigh
svhgpedtmkqlkelfql

Timeline for d6i5xd1:

• d6i5xd1 first appeared in SCOPe 2.07