![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Neosartorya fumigata [TaxId:746128] [377239] (1 PDB entry) |
![]() | Domain d6i5xd1: 6i5x D:7-264 [377289] Other proteins in same PDB: d6i5xa2, d6i5xb2, d6i5xc2, d6i5xd2 automated match to d5ue7a_ complexed with cl, mg, peg |
PDB Entry: 6i5x (more details), 2.2 Å
SCOPe Domain Sequences for d6i5xd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i5xd1 c.108.1.0 (D:7-264) automated matches {Neosartorya fumigata [TaxId: 746128]} lqdrpiknticlfdvdetltparravtpemlmllsqlrhkcaigyvggsnlakqqeqlgt gatdvtslfdfcfpenglmafrlgkplastsfiewigeekyqklvnfilryfadlqlpkk rgtfiefrngminvspigrnasveernefeaydkehhirtdmvnalkkefpdygltysig gqisfdvfptgwdktyclrhveaekeisgveyttihffgdkcfpggndyeiysdprtigh svhgpedtmkqlkelfql
Timeline for d6i5xd1: