Lineage for d6iddk2 (6idd K:323-490)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041907Species Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId:1395981] [377272] (1 PDB entry)
  8. 3041913Domain d6iddk2: 6idd K:323-490 [377285]
    Other proteins in same PDB: d6idda1, d6iddc1, d6idde1, d6iddg1, d6iddi1, d6iddk1
    automated match to d1ha0a2
    complexed with nag; mutant

Details for d6iddk2

PDB Entry: 6idd (more details), 2.38 Å

PDB Description: crystal structure of h7 hemagglutinin mutant sh1-avpl ( s138a, g186v, t221p, q226l) from the influenza virus a/shanghai/1/2013 (h7n9)
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d6iddk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iddk2 h.3.1.0 (K:323-490) automated matches {Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId: 1395981]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

SCOPe Domain Coordinates for d6iddk2:

Click to download the PDB-style file with coordinates for d6iddk2.
(The format of our PDB-style files is described here.)

Timeline for d6iddk2: