SCOPe 2.07: Domain d6iddk1: 6idd K:1-316

Lineage for d6iddk1 (6idd K:1-316)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId:1395981] [377270] (1 PDB entry)

8. Domain d6iddk1: 6idd K:1-316 [377284]
   Other proteins in same PDB: d6idda2, d6iddc2, d6idde2, d6iddg2, d6iddi2, d6iddk2
   automated match to d4we4a_
   complexed with nag; mutant

Details for d6iddk1

PDB Entry: 6idd, 2.38 Å

PDB Description: crystal structure of h7 hemagglutinin mutant sh1-avpl ( s138a, g186v, t221p, q226l) from the influenza virus a/shanghai/1/2013 (h7n9)

PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d6iddk1:

Sequence; same for both SEQRES and ATOM records:

>d6iddk1 b.19.1.0 (K:1-316) automated matches {Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId: 1395981]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

Timeline for d6iddk1:

• d6iddk1 is new in SCOPe 2.07-stable
  
• d6iddk1 appears in the current release, SCOPe 2.08