![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries) |
![]() | Domain d6id9a_: 6id9 A: [377281] Other proteins in same PDB: d6id9b_ automated match to d4n62a_ complexed with nag; mutant |
PDB Entry: 6id9 (more details), 2.7 Å
SCOPe Domain Sequences for d6id9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id9a_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 1332244]} iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt ngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsgstaeq tklygsgnklvtvgssnyqqsfvpspgartqvnglsgridfhwlmlnpndtvtfsfngaf iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq rslllatgmknvpe
Timeline for d6id9a_: