SCOPe 2.07: Domain d6iddi2: 6idd I:323-490

Lineage for d6iddi2 (6idd I:323-490)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId:1395981] [377272] (1 PDB entry)

8. Domain d6iddi2: 6idd I:323-490 [377280]
   Other proteins in same PDB: d6idda1, d6iddc1, d6idde1, d6iddg1, d6iddi1, d6iddk1
   automated match to d1ha0a2
   complexed with nag; mutant

Details for d6iddi2

PDB Entry: 6idd, 2.38 Å

PDB Description: crystal structure of h7 hemagglutinin mutant sh1-avpl ( s138a, g186v, t221p, q226l) from the influenza virus a/shanghai/1/2013 (h7n9)

PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d6iddi2:

Sequence; same for both SEQRES and ATOM records:

>d6iddi2 h.3.1.0 (I:323-490) automated matches {Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId: 1395981]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

Timeline for d6iddi2:

• d6iddi2 is new in SCOPe 2.07-stable
  
• d6iddi2 appears in the current release, SCOPe 2.08