Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId:1395981] [377272] (1 PDB entry) |
Domain d6iddi2: 6idd I:323-490 [377280] Other proteins in same PDB: d6idda1, d6iddc1, d6idde1, d6iddg1, d6iddi1, d6iddk1 automated match to d1ha0a2 complexed with nag; mutant |
PDB Entry: 6idd (more details), 2.38 Å
SCOPe Domain Sequences for d6iddi2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iddi2 h.3.1.0 (I:323-490) automated matches {Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId: 1395981]} lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq qfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn
Timeline for d6iddi2: