SCOPe 2.05: Domain d1c4pd_: 1c4p D:

Lineage for d1c4pd_ (1c4p D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family)
   automatically mapped to Pfam PF02821

5. Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)

6. Protein Streptokinase [54332] (1 species)
   duplication: consists of three similar domains

7. Species Streptococcus equisimilis [TaxId:119602] [54333] (5 PDB entries)

8. Domain d1c4pd_: 1c4p D: [37728]
   domain B

Details for d1c4pd_

PDB Entry: 1c4p, 2.4 Å

PDB Description: beta domain of streptokinase

PDB Compounds: (D:) protein (streptokinase)

SCOPe Domain Sequences for d1c4pd_:

Sequence; same for both SEQRES and ATOM records:

>d1c4pd_ d.15.5.1 (D:) Streptokinase {Streptococcus equisimilis [TaxId: 119602]}
kpiqnqaksvdveytvqftplnpdddfrpglkdtkllktlaigdtitsqellaqaqsiln
kthpgytiyerdssivthdndifrtilpmdqeftyhvknreqayeinkksglneeinntd
lisekyyvlkkg

Timeline for d1c4pd_:

• d1c4pd_ first appeared (with stable ids) in SCOP 1.55
  
• d1c4pd_ appears in SCOPe 2.04
  
• d1c4pd_ appears in SCOPe 2.06
  
• d1c4pd_ appears in the current release, SCOPe 2.08