Lineage for d6iddg1 (6idd G:1-316)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (47 species)
    not a true protein
  7. 3077208Species Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId:1395981] [377270] (1 PDB entry)
  8. 3077209Domain d6iddg1: 6idd G:1-316 [377271]
    Other proteins in same PDB: d6idda2, d6iddc2, d6idde2, d6iddg2, d6iddi2, d6iddk2
    automated match to d4we4a_
    complexed with nag; mutant

Details for d6iddg1

PDB Entry: 6idd (more details), 2.38 Å

PDB Description: crystal structure of h7 hemagglutinin mutant sh1-avpl ( s138a, g186v, t221p, q226l) from the influenza virus a/shanghai/1/2013 (h7n9)
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d6iddg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iddg1 b.19.1.0 (G:1-316) automated matches {Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId: 1395981]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d6iddg1:

Click to download the PDB-style file with coordinates for d6iddg1.
(The format of our PDB-style files is described here.)

Timeline for d6iddg1: