Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.1: Serpins [56573] (1 superfamily) contains a cluster of helices and a beta-sandwich |
Superfamily e.1.1: Serpins [56574] (2 families) |
Family e.1.1.1: Serpins [56575] (17 proteins) automatically mapped to Pfam PF00079 |
Protein automated matches [190484] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188559] (24 PDB entries) |
Domain d6i7ua_: 6i7u A: [377269] automated match to d1hp7a_ |
PDB Entry: 6i7u (more details), 1.55 Å
SCOPe Domain Sequences for d6i7ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i7ua_ e.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnf nlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhsea ftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkd teeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnatmifflpdegklqh lenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvt eeaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntksp lfmgkvvnptqk
Timeline for d6i7ua_: