SCOPe 2.07: Domain d6icxa_: 6icx A:

Lineage for d6icxa_ (6icx A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus [TaxId:1332244] [228093] (27 PDB entries)

8. Domain d6icxa_: 6icx A: [377255]
   Other proteins in same PDB: d6icxb_
   automated match to d4n62a_
   complexed with nag; mutant

Details for d6icxa_

PDB Entry: 6icx, 2.4 Å

PDB Description: crystal structure of h7 hemagglutinin mutant ah-agpl (v186g) from the influenza virus a/anhui/1/2013 (h7n9)

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6icxa_:

Sequence; same for both SEQRES and ATOM records:

>d6icxa_ b.19.1.0 (A:) automated matches {Influenza A virus [TaxId: 1332244]}
iclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgtitg
ppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgirt
ngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsgstaeq
tklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfngaf
iapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryvkq
rslllatgmknvpe

Timeline for d6icxa_:

• d6icxa_ is new in SCOPe 2.07-stable
  
• d6icxa_ appears in the current release, SCOPe 2.08