Lineage for d6idza_ (6idz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776721Domain d6idza_: 6idz A: [377254]
    Other proteins in same PDB: d6idzb_
    automated match to d4n62a_
    complexed with gal, nag, sia; mutant

Details for d6idza_

PDB Entry: 6idz (more details), 2.71 Å

PDB Description: crystal structure of h7 hemagglutinin mutant h7-svtq ( a138s, p221t, l226q) with 3'sln
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6idza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6idza_ b.19.1.0 (A:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpei

SCOPe Domain Coordinates for d6idza_:

Click to download the PDB-style file with coordinates for d6idza_.
(The format of our PDB-style files is described here.)

Timeline for d6idza_: