Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Caulobacter crescentus [TaxId:190650] [337115] (3 PDB entries) |
Domain d6izob3: 6izo B:251-372 [377251] Other proteins in same PDB: d6izoa4, d6izob4 automated match to d5wcea3 complexed with edo, peg |
PDB Entry: 6izo (more details), 1.94 Å
SCOPe Domain Sequences for d6izob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6izob3 d.131.1.0 (B:251-372) automated matches {Caulobacter crescentus [TaxId: 190650]} mrviprdnakiltldndlfakavdrvatisaeksrsvklavepgritltvrnmeagqave evevdydgepfeigfnarylldvcgqiagpqaefrfadpasptlvvdpvdpgvkyvlmpl rv
Timeline for d6izob3:
View in 3D Domains from other chains: (mouse over for more information) d6izoa1, d6izoa2, d6izoa3, d6izoa4 |