Lineage for d6i5xb1 (6i5x B:7-264)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920575Species Neosartorya fumigata [TaxId:746128] [377239] (1 PDB entry)
  8. 2920577Domain d6i5xb1: 6i5x B:7-264 [377240]
    Other proteins in same PDB: d6i5xa2, d6i5xb2, d6i5xc2, d6i5xd2
    automated match to d5ue7a_
    complexed with cl, mg, peg

Details for d6i5xb1

PDB Entry: 6i5x (more details), 2.2 Å

PDB Description: crystal structure of aspergillus fumigatus phosphomannomutase
PDB Compounds: (B:) Phosphomannomutase

SCOPe Domain Sequences for d6i5xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i5xb1 c.108.1.0 (B:7-264) automated matches {Neosartorya fumigata [TaxId: 746128]}
lqdrpiknticlfdvdetltparravtpemlmllsqlrhkcaigyvggsnlakqqeqlgt
gatdvtslfdfcfpenglmafrlgkplastsfiewigeekyqklvnfilryfadlqlpkk
rgtfiefrngminvspigrnasveernefeaydkehhirtdmvnalkkefpdygltysig
gqisfdvfptgwdktyclrhveaekeisgveyttihffgdkcfpggndyeiysdprtigh
svhgpedtmkqlkelfql

SCOPe Domain Coordinates for d6i5xb1:

Click to download the PDB-style file with coordinates for d6i5xb1.
(The format of our PDB-style files is described here.)

Timeline for d6i5xb1: