![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Fragaria ananassa [TaxId:3747] [377209] (5 PDB entries) |
![]() | Domain d6i73b1: 6i73 B:14-119 [377234] Other proteins in same PDB: d6i73a2, d6i73a3, d6i73b2, d6i73b3 automated match to d1kyze1 complexed with edo, h6n, sah, so4 |
PDB Entry: 6i73 (more details), 1.35 Å
SCOPe Domain Sequences for d6i73b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i73b1 a.4.5.0 (B:14-119) automated matches {Fragaria ananassa [TaxId: 3747]} vsdeeanlfamqlasasvlpmvlkaaieldlleimakagpgsflspsdlasqlptknpea pvmldrmlrllasysiltcslrtlpdgkverlyclgpvckfltkne
Timeline for d6i73b1: