SCOPe 2.06: Domain d1qqrb_: 1qqr B:

Lineage for d1qqrb_ (1qqr B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family)
   automatically mapped to Pfam PF02821

5. Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)

6. Protein Streptokinase [54332] (1 species)
   duplication: consists of three similar domains

7. Species Streptococcus equisimilis [TaxId:119602] [54333] (5 PDB entries)

8. Domain d1qqrb_: 1qqr B: [37722]
   domain B

Details for d1qqrb_

PDB Entry: 1qqr, 2.3 Å

PDB Description: crystal structure of streptokinase domain b

PDB Compounds: (B:) streptokinase domain b

SCOPe Domain Sequences for d1qqrb_:

Sequence; same for both SEQRES and ATOM records:

>d1qqrb_ d.15.5.1 (B:) Streptokinase {Streptococcus equisimilis [TaxId: 119602]}
iqnqaksvdveytvqftplnpdddfrpglkltkllktlaigdtitsqellaqaqsilnkn
hpgytiyerdssivthdndifrtilpmdqeftyrvknreqayrinkksglneeinntdli
sekyyvlkkgekp

Timeline for d1qqrb_:

• d1qqrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qqrb_ appears in SCOPe 2.05
  
• d1qqrb_ appears in SCOPe 2.07
  
• d1qqrb_ appears in the current release, SCOPe 2.08