Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Enterobacter cloacae [TaxId:716541] [377187] (1 PDB entry) |
Domain d6ux3c_: 6ux3 C: [377198] Other proteins in same PDB: d6ux3b2 automated match to d1xq1a_ complexed with gol, peg |
PDB Entry: 6ux3 (more details), 2.2 Å
SCOPe Domain Sequences for d6ux3c_:
Sequence, based on SEQRES records: (download)
>d6ux3c_ c.2.1.0 (C:) automated matches {Enterobacter cloacae [TaxId: 716541]} tkvaivtasdsgigkttalmlaergfdigvtwhsdeqgardtcreveaqgrraeaihldl stlpqgaqaietliarfgrldvlvnnagamtkapfldmpfddwrniftvdvdgaflcsqi aarkmveqgeggrivnitsvhehtplpeasaytaakhalggltksmalelvqhnilvnav apgaiatpmndmdesevkegsmpaiplarpgytkeiaslvawlcdsdasyttgqsfivdg gfmlanpqfkp
>d6ux3c_ c.2.1.0 (C:) automated matches {Enterobacter cloacae [TaxId: 716541]} tkvaivtasdsgigkttalmlaergfdigvtwhsdeqgardtcreveaqgrraeaihldl stlpqgaqaietliarfgrldvlvnnagamtkapfldmpfddwrniftvdvdgaflcsqi aarkmveqgeggrivnitsvhehtplpeasaytaakhalggltksmalelvqhnilvnav apgaiatpmndkegsmpaiplarpgytkeiaslvawlcdsdasyttgqsfivdggfmlan pqfkp
Timeline for d6ux3c_:
View in 3D Domains from other chains: (mouse over for more information) d6ux3a_, d6ux3b1, d6ux3b2, d6ux3d_ |