SCOP 1.67: Domain d1buic_: 1bui C:

Lineage for d1buic_ (1bui C:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family)

5. Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)

6. Protein Staphylokinase [54330] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54331] (7 PDB entries)
   phage-borne; Bacteriophage 42D

8. Domain d1buic_: 1bui C: [37719]
   Other proteins in same PDB: d1buia_, d1buib_
   complexed with mai

Details for d1buic_

PDB Entry: 1bui, 2.65 Å

PDB Description: structure of the ternary microplasmin-staphylokinase-microplasmin complex: a proteinase-cofactor-substrate complex in action

SCOP Domain Sequences for d1buic_:

Sequence; same for both SEQRES and ATOM records:

>d1buic_ d.15.5.1 (C:) Staphylokinase {Staphylococcus aureus}
asyfeptgpylmvnvtgvdskgnellsphyvefpikpgttltkekieyyvewaldatayk
efrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnlitkvvie
kk

Timeline for d1buic_:

• d1buic_ first appeared (with stable ids) in SCOP 1.55
  
• d1buic_ appears in SCOP 1.65
  
• d1buic_ appears in SCOP 1.69
  
• d1buic_ appears in the current release, SCOPe 2.08