Lineage for d6ssqb1 (6ssq B:169-408)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729417Protein Retinoic acid receptor beta (RAR-beta) [117011] (2 species)
  7. 2729418Species Human (Homo sapiens) [TaxId:9606] [117013] (3 PDB entries)
    Uniprot P10826 182-416
  8. 2729423Domain d6ssqb1: 6ssq B:169-408 [377174]
    Other proteins in same PDB: d6ssqb2
    automated match to d1xdkb_
    complexed with 754, flc, gol

Details for d6ssqb1

PDB Entry: 6ssq (more details), 2.3 Å

PDB Description: crystal structure of rarbeta lbd in complex with lg 100754
PDB Compounds: (B:) Retinoic acid receptor beta

SCOPe Domain Sequences for d6ssqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ssqb1 a.123.1.1 (B:169-408) Retinoic acid receptor beta (RAR-beta) {Human (Homo sapiens) [TaxId: 9606]}
esyemtaelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkc
iikivefakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrt
qmhnagfgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepl
lealkiyirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemme

SCOPe Domain Coordinates for d6ssqb1:

Click to download the PDB-style file with coordinates for d6ssqb1.
(The format of our PDB-style files is described here.)

Timeline for d6ssqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ssqb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ssqa_