Lineage for d6svaa_ (6sva A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686340Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries)
  8. 2686351Domain d6svaa_: 6sva A: [377171]
    Other proteins in same PDB: d6svab_
    automated match to d2d5xa_
    complexed with hem

Details for d6svaa_

PDB Entry: 6sva (more details), 1.92 Å

PDB Description: multicrystal structure of equine haemoglobin at room temperature using a multilayer monochromator.
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d6svaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6svaa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]}
lsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgkk
vgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpav
hasldkflssvstvltsky

SCOPe Domain Coordinates for d6svaa_:

Click to download the PDB-style file with coordinates for d6svaa_.
(The format of our PDB-style files is described here.)

Timeline for d6svaa_: