Lineage for d1c79a_ (1c79 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179657Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) (S)
    automatically mapped to Pfam PF02821
  5. 2179658Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)
  6. 2179659Protein Staphylokinase [54330] (1 species)
  7. 2179660Species Staphylococcus aureus [TaxId:1280] [54331] (7 PDB entries)
    phage-borne; Bacteriophage 42D
  8. 2179662Domain d1c79a_: 1c79 A: [37716]

Details for d1c79a_

PDB Entry: 1c79 (more details), 2.3 Å

PDB Description: staphylokinase (sak) dimer
PDB Compounds: (A:) staphylokinase

SCOPe Domain Sequences for d1c79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c79a_ d.15.5.1 (A:) Staphylokinase {Staphylococcus aureus [TaxId: 1280]}
gkykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvew
aldataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfn
litkvviekk

SCOPe Domain Coordinates for d1c79a_:

Click to download the PDB-style file with coordinates for d1c79a_.
(The format of our PDB-style files is described here.)

Timeline for d1c79a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1c79b_