SCOPe 2.08: Domain d6ptta_: 6ptt A:

Lineage for d6ptta_ (6ptt A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)

8. Domain d6ptta_: 6ptt A: [377159]
   automated match to d2llna_
   complexed with cua

Details for d6ptta_

PDB Entry: 6ptt, 1.84 Å

PDB Description: soluble model of arabidopsis thaliana cua (tt3lat)

PDB Compounds: (A:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6ptta_:

Sequence; same for both SEQRES and ATOM records:

>d6ptta_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lervdpttvrqegpwadpaqavvqtgpnqytvyvlahqwyyqpnpievpqgaeivfkits
advlhgfhvegtninvevlpgevstvrytfkrpgeyriicseicgtnhafmfgtivvke

Timeline for d6ptta_:

• d6ptta_ first appeared in SCOPe 2.07