Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
Species Achromobacter cycloclastes [TaxId:223] [419324] (51 PDB entries) |
Domain d6qwga1: 6qwg A:8-166 [377154] Other proteins in same PDB: d6qwga2 automated match to d5i6la1 complexed with cu, no2 |
PDB Entry: 6qwg (more details), 1.9 Å
SCOPe Domain Sequences for d6qwga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qwga1 b.6.1.3 (A:8-166) Nitrite reductase, NIR, N-terminal domain {Achromobacter cycloclastes [TaxId: 223]} distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d6qwga1: