Lineage for d1c77b_ (1c77 B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) 
Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) 
Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins) Protein Staphylokinase [54330] (1 species) Species Staphylococcus aureus [TaxId:1280] [54331] (7 PDB entries) 
Domain d1c77b_: 1c77 B: [37715]
Details for d1c77b_
PDB Entry: 1c77 (more details), 2.3 Å
PDB Description: staphylokinase (sak) dimer
SCOP Domain Sequences for d1c77b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c77b_ d.15.5.1 (B:) Staphylokinase {Staphylococcus aureus}
ykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvewal
dataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnli
tkvviekk
SCOP Domain Coordinates for d1c77b_:
Click to download the PDB-style file with coordinates for d1c77b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c77b_:
- d1c77b_ appears in SCOP 1.57
- d1c77b_ appears in the current release, SCOPe 2.08
View in 3D
