SCOPe 2.08: Domain d1c77b_: 1c77 B:

Lineage for d1c77b_ (1c77 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family)
   automatically mapped to Pfam PF02821

5. Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 proteins)

6. Protein Staphylokinase [54330] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54331] (7 PDB entries)
   phage-borne; Bacteriophage 42D

8. Domain d1c77b_: 1c77 B: [37715]

Details for d1c77b_

PDB Entry: 1c77, 2.3 Å

PDB Description: staphylokinase (sak) dimer

PDB Compounds: (B:) staphylokinase

SCOPe Domain Sequences for d1c77b_:

Sequence; same for both SEQRES and ATOM records:

>d1c77b_ d.15.5.1 (B:) Staphylokinase {Staphylococcus aureus [TaxId: 1280]}
ykkgddasyfeptgpylmvnvtgvdgkgnellsphyvefpikpgttltkekieyyvewal
dataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnli
tkvviekk

Timeline for d1c77b_:

• d1c77b_ first appeared (with stable ids) in SCOP 1.55
  
• d1c77b_ appears in SCOPe 2.07