Lineage for d6pbzc3 (6pbz C:307-494)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350195Species Escherichia coli [TaxId:83333] [377121] (1 PDB entry)
  8. 2350198Domain d6pbzc3: 6pbz C:307-494 [377122]
    Other proteins in same PDB: d6pbza1, d6pbza2, d6pbzb1, d6pbzb2, d6pbzc1, d6pbzc2, d6pbzd1, d6pbzd2
    automated match to d2floa1
    complexed with cl

Details for d6pbzc3

PDB Entry: 6pbz (more details), 2.48 Å

PDB Description: crystal structure of escherichia coli gppa
PDB Compounds: (C:) Guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase

SCOPe Domain Sequences for d6pbzc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pbzc3 a.211.1.0 (C:307-494) automated matches {Escherichia coli [TaxId: 83333]}
dirsrtlrniqrrfmididqaqrvakvaanffdqvenewhleaisrdllisacqlheigl
svdfkqapqhaaylvrnldlpgftpaqkkllatlllnqtnpvdlsslhqqnavpprvaeq
lcrllrlaiifasrrrddlvpemtlqanhelltltlpqgwltqhplgkeiiaqesqwqsy
vhwplevh

SCOPe Domain Coordinates for d6pbzc3:

Click to download the PDB-style file with coordinates for d6pbzc3.
(The format of our PDB-style files is described here.)

Timeline for d6pbzc3: