Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (10 species) not a true protein |
Species Escherichia coli [TaxId:83333] [377121] (1 PDB entry) |
Domain d6pbzc3: 6pbz C:307-494 [377122] Other proteins in same PDB: d6pbza1, d6pbza2, d6pbzb1, d6pbzb2, d6pbzc1, d6pbzc2, d6pbzd1, d6pbzd2 automated match to d2floa1 complexed with cl |
PDB Entry: 6pbz (more details), 2.48 Å
SCOPe Domain Sequences for d6pbzc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pbzc3 a.211.1.0 (C:307-494) automated matches {Escherichia coli [TaxId: 83333]} dirsrtlrniqrrfmididqaqrvakvaanffdqvenewhleaisrdllisacqlheigl svdfkqapqhaaylvrnldlpgftpaqkkllatlllnqtnpvdlsslhqqnavpprvaeq lcrllrlaiifasrrrddlvpemtlqanhelltltlpqgwltqhplgkeiiaqesqwqsy vhwplevh
Timeline for d6pbzc3: