Lineage for d2saka_ (2sak A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160254Superfamily d.15.5: Staphylokinase/streptokinase [54328] (1 family) (S)
    automatically mapped to Pfam PF02821
  5. 2160255Family d.15.5.1: Staphylokinase/streptokinase [54329] (2 protein domains)
  6. 2160256Protein Staphylokinase [54330] (1 species)
  7. 2160257Species Staphylococcus aureus [TaxId:1280] [54331] (7 PDB entries)
    phage-borne; Bacteriophage 42D
  8. 2160258Domain d2saka_: 2sak A: [37711]
    complexed with trs

Details for d2saka_

PDB Entry: 2sak (more details), 1.8 Å

PDB Description: staphylokinase (sakstar variant)
PDB Compounds: (A:) staphylokinase

SCOPe Domain Sequences for d2saka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2saka_ d.15.5.1 (A:) Staphylokinase {Staphylococcus aureus [TaxId: 1280]}
syfeptgpylmvnvtgvdskgnellsphyvefpikpgttltkekieyyvewaldatayke
frvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnlitkvviek
k

SCOPe Domain Coordinates for d2saka_:

Click to download the PDB-style file with coordinates for d2saka_.
(The format of our PDB-style files is described here.)

Timeline for d2saka_: