Lineage for d6hzhb1 (6hzh B:268-622)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014345Species Chlamydia trachomatis [TaxId:813] [377002] (4 PDB entries)
  8. 3014349Domain d6hzhb1: 6hzh B:268-622 [377087]
    Other proteins in same PDB: d6hzha2, d6hzhb2
    automated match to d5uy7a_

Details for d6hzhb1

PDB Entry: 6hzh (more details), 1.83 Å

PDB Description: apo structure of tp domain from chlamydia trachomatis penicillin- binding protein 3
PDB Compounds: (B:) penicillin-binding protein

SCOPe Domain Sequences for d6hzhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hzhb1 e.3.1.0 (B:268-622) automated matches {Chlamydia trachomatis [TaxId: 813]}
ltinadlqrvaeeslnaavkrvggvwgsaavleigtgrllalapggtrsvsaiyepgsvg
klvtlaaaidqkkvtptstftvsstrdmpngerisddsphetqdmtvagiiahsyntgtv
qigdtvsdsvryeymqkfgwgaktgitlpseesgilrphtewgdrdhyttmfgqgvavtt
iqlaqmvavfgqkgvlippriidgyddengvytptvmgesrqvvsedtaqtvlnimqgat
qpggtaegigavkgynvaaktgtaenvgssgsltdtaatftalipaenpkiavavviyke
ngtvygstasapvfvdiaqfamremkippstvplykypw

SCOPe Domain Coordinates for d6hzhb1:

Click to download the PDB-style file with coordinates for d6hzhb1.
(The format of our PDB-style files is described here.)

Timeline for d6hzhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6hzhb2