![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
![]() | Protein automated matches [190857] (70 species) not a true protein |
![]() | Species Chlamydia trachomatis [TaxId:813] [377002] (4 PDB entries) |
![]() | Domain d6hzhb1: 6hzh B:268-622 [377087] Other proteins in same PDB: d6hzha2, d6hzhb2 automated match to d5uy7a_ |
PDB Entry: 6hzh (more details), 1.83 Å
SCOPe Domain Sequences for d6hzhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hzhb1 e.3.1.0 (B:268-622) automated matches {Chlamydia trachomatis [TaxId: 813]} ltinadlqrvaeeslnaavkrvggvwgsaavleigtgrllalapggtrsvsaiyepgsvg klvtlaaaidqkkvtptstftvsstrdmpngerisddsphetqdmtvagiiahsyntgtv qigdtvsdsvryeymqkfgwgaktgitlpseesgilrphtewgdrdhyttmfgqgvavtt iqlaqmvavfgqkgvlippriidgyddengvytptvmgesrqvvsedtaqtvlnimqgat qpggtaegigavkgynvaaktgtaenvgssgsltdtaatftalipaenpkiavavviyke ngtvygstasapvfvdiaqfamremkippstvplykypw
Timeline for d6hzhb1: