Lineage for d6n3ka1 (6n3k A:1-335)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903165Species Trichoderma reesei [TaxId:334564] [377080] (5 PDB entries)
  8. 2903168Domain d6n3ka1: 6n3k A:1-335 [377081]
    Other proteins in same PDB: d6n3ka2
    automated match to d4c4za_
    complexed with k9v

Details for d6n3ka1

PDB Entry: 6n3k (more details), 2.2 Å

PDB Description: crystal structure of an epoxide hydrolase from trichoderma reesei in complex with inhibitor 1
PDB Compounds: (A:) epoxide hydrolase

SCOPe Domain Sequences for d6n3ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n3ka1 c.69.1.0 (A:1-335) automated matches {Trichoderma reesei [TaxId: 334564]}
mdtsklkpndprvkyetkqirgktysyilgepagpkletvvlvhgwpdmafgwrhqipyl
mslgfqvvapnmlgyagtdaprdlsqftlksvsadiaelarsfvgqdgqivlgghdwgga
vvwrtayyhpelvkavfsvctplhplsaeykpledivaaghmlnfkyqlqlkgpdveari
qgkdmlrrfframfggrgpngeagfstsdgvhfdvldkigapplldeqeleyyveqyalq
eapelrgplnwyrtrelnakdemdrakngpplrfempalfvaaskdnalppamskgmdaf
ykdltraevdathwaltqagdevnrvigewlnkal

SCOPe Domain Coordinates for d6n3ka1:

Click to download the PDB-style file with coordinates for d6n3ka1.
(The format of our PDB-style files is described here.)

Timeline for d6n3ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6n3ka2