SCOPe 2.08: Domain d6iskb_: 6isk B:

Lineage for d6iskb_ (6isk B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Streptomyces xiamenensis [TaxId:1093097] [377042] (2 PDB entries)

8. Domain d6iskb_: 6isk B: [377043]
   automated match to d3er7b_
   complexed with edo, mla

Details for d6iskb_

PDB Entry: 6isk, 1.77 Å

PDB Description: snoal-like cyclase xime

PDB Compounds: (B:) XimE, SnoaL-like domain protein

SCOPe Domain Sequences for d6iskb_:

Sequence; same for both SEQRES and ATOM records:

>d6iskb_ d.17.4.0 (B:) automated matches {Streptomyces xiamenensis [TaxId: 1093097]}
thtaldrymeladravrdpsalaelptifapdatvtlrdepvtgmpaimefyrvfvaava
eskhywtttiledgtieshwvvaarradgslmtaagvehatvdtdglitnlrnrytrtpg

Timeline for d6iskb_:

• d6iskb_ first appeared in SCOPe 2.07