SCOPe 2.08: Domain d6i1fa1: 6i1f A:263-601

Lineage for d6i1fa1 (6i1f A:263-601)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:813] [377002] (4 PDB entries)

8. Domain d6i1fa1: 6i1f A:263-601 [377027]
   Other proteins in same PDB: d6i1fa2, d6i1fb2
   automated match to d5uy7a_
   complexed with axl

Details for d6i1fa1

PDB Entry: 6i1f, 1.89 Å

PDB Description: crystal structure of tp domain from chlamydia trachomatis penicillin- binding protein 3 in complex with amoxicillin

PDB Compounds: (A:) Penicillin-binding protein,Penicillin-binding protein

SCOPe Domain Sequences for d6i1fa1:

Sequence; same for both SEQRES and ATOM records:

>d6i1fa1 e.3.1.0 (A:263-601) automated matches {Chlamydia trachomatis [TaxId: 813]}
ltinadlqrvaeeslnaavkrvggvwgsaavleigtgrllalapggtrsvsaiyepgsvg
klvtlaaaidqkkvtptstftvsstrdmpngerisddsphetqdmtvagiiahsyntgtv
qigdtvsdsvryeymqkfgwgaktgitlpseesgilrphtewgdrdhyttmfgqgvavtt
iqlaqmvavfgqkgvlippriidgyddengvytptvmgesrqvvsedtaqtvlnimqgat
qpggtaegigavkgynvaaktgtaenvgssgsltdtaatftalipaenpkiavavviyke
ngtvygstasapvfvdiaqfamremkippstvplykypw

Timeline for d6i1fa1:

• d6i1fa1 first appeared in SCOPe 2.07