SCOPe 2.08: Domain d6i7fa_: 6i7f A:

Lineage for d6i7fa_ (6i7f A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Amphitrite ornata [TaxId:129555] [189339] (47 PDB entries)

8. Domain d6i7fa_: 6i7f A: [377022]
   automated match to d5lkva_
   complexed with 5jc, hem, so4

Details for d6i7fa_

PDB Entry: 6i7f, 1.85 Å

PDB Description: dehaloperoxidase b from amphitrite ornata - complex with 2,4- dichlorophenol

PDB Compounds: (A:) Dehaloperoxidase B

SCOPe Domain Sequences for d6i7fa_:

Sequence; same for both SEQRES and ATOM records:

>d6i7fa_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d6i7fa_:

• d6i7fa_ first appeared in SCOPe 2.07