SCOPe 2.07: Domain d1ffua2: 1ffu A:3-81

Lineage for d1ffua2 (1ffu A:3-81)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (3 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)

8. Domain d1ffua2: 1ffu A:3-81 [37702]
   Other proteins in same PDB: d1ffua1, d1ffub1, d1ffub2, d1ffuc1, d1ffuc2, d1ffud1, d1ffue1, d1ffue2, d1ffuf1, d1ffuf2
   complexed with cdp, fad, fes

Details for d1ffua2

PDB Entry: 1ffu, 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

PDB Compounds: (A:) cuts, iron-sulfur protein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffua2:

Sequence; same for both SEQRES and ATOM records:

>d1ffua2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc
thlavqcdgsevltvegla

Timeline for d1ffua2:

• d1ffua2 first appeared (with stable ids) in SCOP 1.55
  
• d1ffua2 appears in SCOPe 2.06
  
• d1ffua2 appears in the current release, SCOPe 2.08