Lineage for d6hgub1 (6hgu B:1-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356349Domain d6hgub1: 6hgu B:1-112 [377017]
    Other proteins in same PDB: d6hgub2, d6hgul2
    automated match to d1t66c1
    complexed with epe, gol

Details for d6hgub1

PDB Entry: 6hgu (more details), 1.5 Å

PDB Description: crystal structure of an anti-app-tag fab
PDB Compounds: (B:) anti-APP-tag Fab light-chain

SCOPe Domain Sequences for d6hgub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hgub1 b.1.1.1 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqnthvpltfgagtklelk

SCOPe Domain Coordinates for d6hgub1:

Click to download the PDB-style file with coordinates for d6hgub1.
(The format of our PDB-style files is described here.)

Timeline for d6hgub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6hgub2