SCOPe 2.04: Domain d1ffvd2: 1ffv D:2-81

Lineage for d1ffvd2 (1ffv D:2-81)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)

8. Domain d1ffvd2: 1ffv D:2-81 [37701]
   Other proteins in same PDB: d1ffva1, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd1, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2
   complexed with fad, fes, pcd

Details for d1ffvd2

PDB Entry: 1ffv, 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

PDB Compounds: (D:) cuts, iron-sulfur protein of carbon monoxide dehydrogenase

SCOPe Domain Sequences for d1ffvd2:

Sequence; same for both SEQRES and ATOM records:

>d1ffvd2 d.15.4.2 (D:2-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]}
akkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvks
cthlavqcdgsevltvegla

Timeline for d1ffvd2:

• d1ffvd2 first appeared (with stable ids) in SCOP 1.55
  
• d1ffvd2 appears in SCOPe 2.03
  
• d1ffvd2 appears in SCOPe 2.05
  
• d1ffvd2 appears in the current release, SCOPe 2.08